Q: I am testing a mouse sample with human xenograft for GBM and I am looking for an MSH6 Antibody that will only detect the human cells.

A: Currently, we have no validation that any of our MSH6 antibodies will not cross react with mouse. All of our MSH6 Antibodies are raised against Human MSH6 so we have checked the % homology with mouse MSH6 which has come to be 85%. As 85% is very high, the chances of the antibody detecting the mouse tissue as well as the human tissue are high.

Recombinant Human MSH6 GST (N-Term) Protein

Novus Biologicals | Catalog # H00002956-Q01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

View all MSH6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human MSH6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MSH6 GST (N-Term) Protein

SDS-PAGE: Recombinant Human MSH6 GST (N-Term) Protein [H00002956-Q01]

SDS-Page: Recombinant Human MSH6 Protein [H00002956-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00002956-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: MSH6

MSH6 - mutS homolog 6 (E. coli)

Alternate Names

DNA mismatch repair protein Msh6, G/T mismatch-binding protein, GTBPHNPCC5, GTMBP, hMSH6, HSAP, mutS (E. coli) homolog 6, mutS homolog 6 (E. coli), MutS-alpha 160 kDa subunit, p160, sperm-associated protein

Gene Symbol

MSH6

Additional MSH6 Products

Product Documents for Recombinant Human MSH6 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human MSH6 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human MSH6 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human MSH6 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human MSH6 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image