MT2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-15974

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human MT2A (NP_005944.1). MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MT2A Antibody - BSA Free

Western Blot: MT2A AntibodyAzide and BSA Free [NBP3-15974]

Western Blot: MT2A AntibodyAzide and BSA Free [NBP3-15974]

Western Blot: MT2A Antibody [NBP3-15974] - Analysis of extracts of various cell lines, using MT2A Rabbit pAb (NBP3-15974) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody [NBP3-15974] - Rat ovary using MT2A Rabbit pAb (NBP3-15974) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody [NBP3-15974] - Human liver cancer using MT2A Rabbit pAb (NBP3-15974) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody - Azide and BSA Free [NBP3-15974]

Immunohistochemistry-Paraffin: MT2A Antibody [NBP3-15974] - Mouse spinal cord using MT2A Rabbit pAb (NBP3-15974) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for MT2A Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MT2A

Long Name

Metallothionein 2A

Alternate Names

MT-II

Gene Symbol

MT2A

Additional MT2A Products

Product Documents for MT2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MT2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for MT2A Antibody - BSA Free

Customer Reviews for MT2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MT2A Antibody - BSA Free and earn rewards!

Have you used MT2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...