MTBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55351

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTBP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PKLATKTSSGQKSMHESKTSRQIKESRSQKHTRILKEVVTETLKKHSITETHECFTACSQRLFEISKFYLKDLKTSRGLFEEMKKTANNN

Reactivity Notes

Mouse 81%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTBP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MTBP Antibody [NBP2-55351]

Immunocytochemistry/ Immunofluorescence: MTBP Antibody [NBP2-55351]

Immunocytochemistry/Immunofluorescence: MTBP Antibody [NBP2-55351] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for MTBP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTBP

The p53 tumor-suppressor gene integrates numerous signals that control cell life and death. Several molecules involved in p53 network, including Chk2, p53R2, p53AIP1, Noxa, PIDD, PID/MTA2, and MTBP, were recently discovered. The transcriptional activity of p53 is modulated by posttranslational regulations of the p53 protein including stabilization and acetylation. P53 transcriptionally activates MDM2 gene then the translated MDM2 protein binds to p53 and promotes the degradation of p53 leading to lowering the concentration of p53 protein. MDM2 inhibits both p53 mediated G1 arrest and apoptosis. A recently discovered protein termed MTBP was found to bind to MDM2 and to inhibit the modulation effect of MDM2 on p53. MTBP is expressed in a variety of normal tissues.

Alternate Names

hMTBP, MDM2 (mouse double minute 2)-binding protein, 104kD, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) bindingprotein, 104kDa, mdm2-binding protein, MDM2BP

Gene Symbol

MTBP

Additional MTBP Products

Product Documents for MTBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTBP Antibody - BSA Free and earn rewards!

Have you used MTBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies