MTF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86379

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTF1 Antibody - BSA Free

Western Blot: MTF1 Antibody [NBP1-86379]

Western Blot: MTF1 Antibody [NBP1-86379]

Western Blot: MTF1 Antibody [NBP1-86379] - Analysis in control (vector only transfected HEK293T lysate) and MTF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MTF1 Antibody [NBP1-86379]

Immunocytochemistry/ Immunofluorescence: MTF1 Antibody [NBP1-86379]

Immunocytochemistry/Immunofluorescence: MTF1 Antibody [NBP1-86379] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379] - Staining of human endometrium shows weak positivity in nuclear membrane in glandular cells.
MTF1 Antibody - BSA Free Immunohistochemistry-Paraffin: MTF1 Antibody - BSA Free [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody - BSA Free [NBP1-86379]

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
MTF1 Antibody - BSA Free Immunohistochemistry-Paraffin: MTF1 Antibody - BSA Free [NBP1-86379]

Immunohistochemistry-Paraffin: MTF1 Antibody - BSA Free [NBP1-86379]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
MTF1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: MTF1 Antibody - BSA Free [NBP1-86379]

Chromatin Immunoprecipitation-exo-Seq: MTF1 Antibody - BSA Free [NBP1-86379]

ChIP-Exo-Seq composite graph for Anti-MTF1 (NBP1-86379) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
MTF1 Antibody - BSA Free

Western Blot: MTF1 Antibody - BSA Free [NBP1-86379] -

The effects of PTZ-kindling in GPR39 KO or WT mice and chronic treatment with TC-G 1008 (10 mg/kg) on zinc levels in serum and hippocampus. a The PTZ kindling in GPR39 KO or WT (C57BL/6/Tar × CBA/Tar) mice consisted of 14 injections of PTZ (25 mg/kg). The biochemical analyses were performed 24 h after the last PTZ injection. b Total zinc (protein bound and [Zn2+]I) was measured in serum by ICP-OES. Data are expressed as means +/- SEM. n = 8 WT VEH, n = 6 WT TC-G 1008, n = 7 KO VEH, n = 7 KO TC-G 1008. c Total zinc was analyzed semi-quantitatively in coronal hippocampal sections by LA-ICP-MS. Data are expressed as means +/- SEM of counts per second (CPS). n = 4 in each group. d The protein expression level of the putative [Zn2+]I sensor, metal regulatory transcription factor 1 (MTF1), was analyzed in the hippocampus. The results (means +/- SEM) are presented as the MTF1/ beta -actin ratio. n = 7 in each group. e Representative blots of MTF1. The observed band (~ 130 kDa). f–h [Zn2+]I was examined in coronal hippocampal sections by a cell-membrane permeable probe, Zinpyr-1 (ZP-1). The mean ZP-1 grey values ratio between mouse sections in the CA3, CA1, or dentate gyrus (DG) regions of the hippocampus is shown. n = 6 WT VEH, n = 6 WT TC-G 1008, n = 5 KO VEH, n = 6 KO TC-G 1008. i A greyscale image of the hippocampal section after staining with ZP-1. p values were determined by two-way ANOVA and Bonferroni’s multiple comparison test. *p < 0.05 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37185787), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MTF1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTF1

MTF1 encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Alternate Names

metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF

Gene Symbol

MTF1

Additional MTF1 Products

Product Documents for MTF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MTF1 Antibody - BSA Free

Customer Reviews for MTF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTF1 Antibody - BSA Free and earn rewards!

Have you used MTF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...