MTMR1 Antibody (1F10) - Azide and BSA Free

Novus Biologicals | Catalog # H00008776-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1F10

Format

Azide and BSA Free
View all MTMR1 Primary Antibodies »

Product Specifications

Immunogen

MTMR1 (NP_003819.1, 39 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD

Specificity

MTMR1 - myotubularin related protein 1 (1F10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MTMR1 Antibody (1F10) - Azide and BSA Free

Western Blot: MTMR1 Antibody (1F10) [H00008776-M01]

Western Blot: MTMR1 Antibody (1F10) [H00008776-M01]

Western Blot: MTMR1 Antibody (1F10) [H00008776-M01] - Analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody (M01), clone 1F10.Lane 1: MTMR1 transfected lysate(39.8 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: MTMR1 Antibody (1F10) [H00008776-M01] - Detection limit for recombinant GST tagged MTMR1 is 0.3 ng/ml as a capture antibody.

Applications for MTMR1 Antibody (1F10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MTMR1

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1

Entrez Gene IDs

8776 (Human)

Gene Symbol

MTMR1

UniProt

NP_003819 (Human)

Additional MTMR1 Products

Product Documents for MTMR1 Antibody (1F10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTMR1 Antibody (1F10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTMR1 Antibody (1F10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MTMR1 Antibody (1F10) - Azide and BSA Free and earn rewards!

Have you used MTMR1 Antibody (1F10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies