MTO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54767

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MTO1 Antibody - BSA Free

Western Blot: MTO1 Antibody [NBP1-54767]

Western Blot: MTO1 Antibody [NBP1-54767]

Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi lane). Image provided by Maria Holmstrom of Gothenburg University.
Western Blot: MTO1 Antibody [NBP1-54767]

Western Blot: MTO1 Antibody [NBP1-54767]

Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Applications for MTO1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-54767 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTO1

MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

EC 1.1.1.40, EC 6.3.5, homolog of yeast Mto1, mitochondrial MTO1-3, mitochondrial translation optimization 1 homolog (S. cerevisiae), protein MTO1 homolog, mitochondrial

Entrez Gene IDs

25821 (Human)

Gene Symbol

MTO1

UniProt

Additional MTO1 Products

Product Documents for MTO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MTO1 Antibody - BSA Free

Customer Reviews for MTO1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MTO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: HeLA whole cell lysate and lysate enriched for mitochondria by digitonin treatment; human fibroblast whole cell lysate
    Species: Human
    Verified Customer | Posted 08/23/2013
    MTO1 Antibody - BSA Free NBP1-54767

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...