mtTFA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56077

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all mtTFA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for mtTFA Antibody - BSA Free

Western Blot: mtTFA Antibody [NBP2-56077]

Western Blot: mtTFA Antibody [NBP2-56077]

Western Blot: mtTFA Antibody [NBP2-56077] - Analysis in human cell lines Caco-2 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western Blot: mtTFA Antibody [NBP2-56077]

Western Blot: mtTFA Antibody [NBP2-56077]

Western Blot: mtTFA Antibody [NBP2-56077] - Analysis using Anti-TFAM antibody NBP2-56077 (A) shows similar pattern to independent antibody NBP1-86959 (B).
Immunocytochemistry/ Immunofluorescence: mtTFA Antibody [NBP2-56077]

Immunocytochemistry/ Immunofluorescence: mtTFA Antibody [NBP2-56077]

Immunocytochemistry/Immunofluorescence: mtTFA Antibody [NBP2-56077] - Staining of human cell line RH-30 shows localization to mitochondria.

Applications for mtTFA Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: mtTFA

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Alternate Names

mitochondrial transcription factor A, MTTF1, mtTFA, TCF-6, TCF6L1, TCF6L2Mitochondrial transcription factor 1, TCF6TCF6L3, Transcription factor 6, Transcription factor 6-like 2, Transcription factor 6-like 2 (mitochondrial transcription factor), transcription factor A, mitochondrial

Gene Symbol

TFAM

Additional mtTFA Products

Product Documents for mtTFA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for mtTFA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mtTFA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mtTFA Antibody - BSA Free and earn rewards!

Have you used mtTFA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies