MUC17 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91013
![Western Blot: MUC17 Antibody [NBP1-91013]](https://resources.rndsystems.com/images/products/MUC17-Antibody-Western-Blot-NBP1-91013-img0003.jpg "Western Blot: MUC17 Antibody [NBP1-91013]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MUC17 Antibody - BSA Free
Western Blot: MUC17 Antibody [NBP1-91013]
Western Blot: MUC17 Antibody [NBP1-91013] - Analysis of AsPC-1 cell lysate (20ug loaded). Image from verified customer review.![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]](https://resources.rndsystems.com/images/products/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0008.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]")
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human fallopian tube shows no positivity in glandular cells as expected.![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]](https://resources.rndsystems.com/images/products/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0009.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]")
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human colon shows weak cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]](https://resources.rndsystems.com/images/products/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0010.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]")
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013]
Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human small intestine shows moderate membranous positivity in glandular cells.![MUC17 Antibody - BSA Free Immunohistochemistry: MUC17 Antibody - BSA Free [NBP1-91013]](https://resources.rndsystems.com/images/products/nbp1-91013_rabbit-polyclonal-muc17-antibody-3052025753417.jpg "Immunohistochemistry: MUC17 Antibody - BSA Free [NBP1-91013]")
Immunohistochemistry: MUC17 Antibody - BSA Free [NBP1-91013]
Staining of human duodenum shows moderate membranous positivity in glandular cells.![MUC17 Antibody - BSA Free Immunohistochemistry: MUC17 Antibody - BSA Free [NBP1-91013]](https://resources.rndsystems.com/images/products/nbp1-91013_rabbit-polyclonal-muc17-antibody-3052025101436.jpg "Immunohistochemistry: MUC17 Antibody - BSA Free [NBP1-91013]")
Applications for MUC17 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Reported in the scientific literature (PMID: 25595893)
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
Validated from a verified customer review
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP1-91013 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MUC17
Alternate Names
membrane mucin MUC17, MUC-3, mucin 17, cell surface associated, secreted mucin MUC17, small intestinal mucin MUC3, small intestinal mucin-3
Gene Symbol
MUC17
Additional MUC17 Products
Product Documents for MUC17 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MUC17 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for MUC17 Antibody - BSA Free
Powered by Bioz
Customer Reviews for MUC17 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used MUC17 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
-(01-ml)_NBP1-91013_10556.jpg)
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Human Pancreatic Cancer Cell lineSpecies: HumanVerified Customer | Posted 09/26/2014MUC17 western NBP1-91013
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...