Recombinant Human Muscleblind-like 1 GST (N-Term) Protein

Name: Recombinant Human Muscleblind-like 1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004154-P02
Price: 799 USD
Availability: InStock
Rating: 5 (1 reviews)

Novus Biologicals | Catalog # H00004154-P02

(1)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all Muscleblind-like 1 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-382 of Human MBNL1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

67.76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Application Notes

Use in Western Blot reported in customer review.

Protein / Peptide Type

Recombinant Protein

Reviewed Applications

Read 1 review rated 5 using H00004154-P02 in the following applications:

Western Blot (1 Review)

Scientific Data Images for Recombinant Human Muscleblind-like 1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00004154-P02

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

MBNL1( AAH43493, 1 a.a. - 383 a.a.) recombinant protein with GST.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Gene Symbol

MBNL1

Additional Muscleblind-like 1 Products

Product Documents for Recombinant Human Muscleblind-like 1 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human Muscleblind-like 1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Muscleblind-like 1 GST (N-Term) Protein (1)

5 out of 5

1 Customer Rating

5 Stars

100%

4 Stars

3 Stars

2 Stars

1 Stars

Have you used Recombinant Human Muscleblind-like 1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

Showing 1 - 1 of 1 review Showing All

Filter By:

Name: arti modi

Application: Western Blot

Sample Tested: Muscleblind-like 1 Recombinant Protein

Species: Mouse

Verified Customer | Posted 05/12/2010

There are no reviews that match your criteria.