![Western Blot: MVP Antibody [NBP2-56408]](https://resources.rndsystems.com/images/products/MVP-Antibody-Western-Blot-NBP2-56408-img0007.jpg "Western Blot: MVP Antibody [NBP2-56408]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Predicted:
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MVP Antibody - BSA Free
![Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]](https://resources.rndsystems.com/images/products/MVP-Antibody-Immunohistochemistry-Paraffin-NBP2-56408-img0006.jpg "Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]")
![Immunohistochemistry: MVP Antibody [NBP2-56408]](https://resources.rndsystems.com/images/products/MVP-Antibody-Immunohistochemistry-NBP2-56408-img0003.jpg "Immunohistochemistry: MVP Antibody [NBP2-56408]")
Immunohistochemistry: MVP Antibody [NBP2-56408]
Immunohistochemistry: MVP Antibody [NBP2-56408] - Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]](https://resources.rndsystems.com/images/products/MVP-Antibody-Immunohistochemistry-Paraffin-NBP2-56408-img0004.jpg "Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]")
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human pancreas shows low expression as expected.![Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]](https://resources.rndsystems.com/images/products/MVP-Antibody-Immunohistochemistry-Paraffin-NBP2-56408-img0005.jpg "Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]")
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408]
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human small intestine shows high expression.Applications for MVP Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MVP
Alternate Names
LRPVAULT1, Lung resistance-related protein, major vault protein
Gene Symbol
MVP
Additional MVP Products
Product Documents for MVP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MVP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MVP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MVP Antibody - BSA Free and earn rewards!
Have you used MVP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for MVP Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?
A: At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
Loading...