Myosin 1B Antibody (3W1C6)

Novus Biologicals | Catalog # NBP3-33271

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3W1C6
View all Myosin 1B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 916-1136 of Human Myosin 1B (NP_001123630.1).

Sequence:
RIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myosin 1B Antibody (3W1C6)

Myosin 1B Antibody (3W1C6)

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] -

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] - Western blot analysis of various lysates using Myosin 1B Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Myosin 1B Antibody (3W1C6)

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] -

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] - Western blot analysis of lysates from Mouse lung, using Myosin 1B Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Myosin 1B Antibody (3W1C6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin 1B

Myosin 1B is a motor protein which is involved in neuronal development, membrane trafficking/dynamics and functions including cell migration, vesicular transport and neurite outgrowth. Myosin 1B is known to have interactions with other proteins such as MAP3K3, RIPK3, BRF2, EIF4A2 and CIAO1. Myosin 1B has been studied in relation to neuronitis, amebiasis and dysentery.

Alternate Names

MMIa, MMI-alpha, MYH-1c, MYO1B variant protein, Myosin I alpha, myosin IB, myosin-I alpha, myosin-Ib, myr1

Gene Symbol

MYO1B

Additional Myosin 1B Products

Product Documents for Myosin 1B Antibody (3W1C6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin 1B Antibody (3W1C6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin 1B Antibody (3W1C6)

There are currently no reviews for this product. Be the first to review Myosin 1B Antibody (3W1C6) and earn rewards!

Have you used Myosin 1B Antibody (3W1C6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies