Myosin VB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38561

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1440-1690 of human Myosin VB (NP_001073936.1).

Sequence:
AQALAQSERKRHELNRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGVLQPMIVSAMLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQVFKQLFYMIN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

214 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myosin VB Antibody - BSA Free

Myosin VB Antibody

Immunocytochemistry/ Immunofluorescence: Myosin VB Antibody [NBP3-38561] -

Immunocytochemistry/ Immunofluorescence: Myosin VB Antibody [NBP3-38561] - Immunofluorescence analysis of paraffin-embedded Human colon carcinoma using Myosin VB Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myosin VB Antibody

Immunocytochemistry/ Immunofluorescence: Myosin VB Antibody [NBP3-38561] -

Immunocytochemistry/ Immunofluorescence: Myosin VB Antibody [NBP3-38561] - Immunofluorescence analysis of paraffin-embedded Human placenta using Myosin VB Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myosin VB Antibody

Western Blot: Myosin VB Antibody [NBP3-38561] -

Western Blot: Myosin VB Antibody [NBP3-38561] - Western blot analysis of various lysates using Myosin VB Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.

Applications for Myosin VB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin VB

Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.

Alternate Names

KIAA1119, MYO5B variant protein, myosin VB, myosin-Vb

Gene Symbol

MYO5B

Additional Myosin VB Products

Product Documents for Myosin VB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myosin VB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin VB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin VB Antibody - BSA Free and earn rewards!

Have you used Myosin VB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...