N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94188

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all N-Acetylglucosaminyltransferase V/MGAT5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human N-Acetylglucosaminyltransferase V/MGAT5 (NP_002401.1). HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] -

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] - Western blot analysis of extracts of various cell lines, using N-Acetylglucosaminyltransferase V/MGAT5 Rabbit pAb antibody (A10567) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] -

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] - Western blot analysis of extracts of various cell lines, using N-Acetylglucosaminyltransferase V/MGAT5 Rabbit pAb antibody (A10567) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Applications for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: N-Acetylglucosaminyltransferase V/MGAT5

MGAT5 - mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase

Long Name

alpha-1,6-Mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A

Alternate Names

MGAT5, N-Acetylglucosaminyltransferase V

Gene Symbol

MGAT5

Additional N-Acetylglucosaminyltransferase V/MGAT5 Products

Product Documents for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free and earn rewards!

Have you used N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies