N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

Novus Biologicals | Catalog # NBP3-33260

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5T9K10
View all N-Acetylmannosamine Kinase/GNE Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 623-722 of human N-Acetylmannosamine Kinase/GNE (Q9Y223).

Sequence:
GALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

Western Blot: N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) [NBP3-33260] -

Western Blot: N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) [NBP3-33260] - Western blot analysis of various lysates using N-Acetylmannosamine Kinase/GNE Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: N-Acetylmannosamine Kinase/GNE

The protein encoded by the GNE gene is a bifunctional enzyme that monitors and begins biosynthesis of N-acetylneuraminic acid (NeuAc). NeuAC is a precursor of sialic acids and functions in early development as sialylation is a component of cell adhesion, signal transduction, and tumorigencity and metastic behavior of malignant cells. The GNE gene has been linked to various diseases such as: myopathy, dementia, glomerulosclerosis, muscular dystrophy, and neuromuscular disease. This protein creates an enzyme that is rate-limiting in the sialic acid biosynthetic pathway as well as plays a role in amino and nucleotide sugar metabolism as well as CMP-N-acetylneuraminate biosynthesis in eukaryotes. The GNE gene is known to interact with genes CRMP1. ZBTB16, PIK3C2A, KIAA1549, and RIF1 to participate in these pathways. GNE exists is five isoforms: isoform 1: 722 amino acids long; 79 kDA; isoform 2: 753 amino acids long, 83 kDA; isoform 3: 681 amino acids long; 74 kDA; isoform 4: 648 amino acids long, 71 kDA; isoform 5: 612 amino acids long, 66 kDA.

Long Name

Glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine Kinase

Alternate Names

DMRV, GLCNE, GNE, IBM2, NAcetylmannosamine Kinase, Uae1

Gene Symbol

GNE

Additional N-Acetylmannosamine Kinase/GNE Products

Product Documents for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

There are currently no reviews for this product. Be the first to review N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) and earn rewards!

Have you used N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies