NAPRT1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87244
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse, Chinese Hamster
Cited:
Human, Mouse, Hamster - Cricetulus (Chinese Hamster)
Predicted:
Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
Reactivity Notes
Chinese Hamster, Mouse reactivity reported in scientific literature (PMID: 24204194).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NAPRT1 Antibody - BSA Free
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87244 (A) shows similar protein distribution across tissues to independent antibody NBP1-87243 (B).Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human placenta shows moderate cytoplasmic positivity in tropoblastic cells.Applications for NAPRT1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Knockdown Validated
Validated for Knockdown from a verified customer review.
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP1-87244 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NAPRT1
Alternate Names
EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856
Entrez Gene IDs
93100 (Human)
Gene Symbol
NAPRT
UniProt
Additional NAPRT1 Products
Product Documents for NAPRT1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NAPRT1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NAPRT1 Antibody - BSA Free
Customer Reviews for NAPRT1 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used NAPRT1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Knockdown ValidatedSample Tested: primary neonatal ventricular cardiomyocytesSpecies: RatVerified Customer | Posted 11/28/2023Immunoblot using primary cultured rat cardiomyocyte with Naprt1 knockdown using the siRNA.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...