NAPRT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87244

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Chinese Hamster

Cited:

Human, Mouse, Hamster - Cricetulus (Chinese Hamster)

Predicted:

Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NAPRT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP

Reactivity Notes

Chinese Hamster, Mouse reactivity reported in scientific literature (PMID: 24204194).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NAPRT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Analysis in human small intestine and skeletal muscle tissues using NBP1-87244 antibody. Corresponding NAPRT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody NBP1-87244 (A) shows similar protein distribution across tissues to independent antibody NBP1-87243 (B).
Western Blot: NAPRT1 Antibody [NBP1-87244]

Western Blot: NAPRT1 Antibody [NBP1-87244]

Western Blot: NAPRT1 Antibody [NBP1-87244] - Analysis using Anti-NAPRT antibody NBP1-87244 (A) shows similar pattern to independent antibody NBP1-87243 (B).
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244]

Immunohistochemistry-Paraffin: NAPRT1 Antibody [NBP1-87244] - Staining of human placenta shows moderate cytoplasmic positivity in tropoblastic cells.
NAPRT1 Antibody

Western Blot: Rabbit Polyclonal NAPRT1 Antibody [NBP1-87244] -

Western Blot: Rabbit Polyclonal NAPRT1 Antibody [NBP1-87244] - Immunoblot using primary cultured rat cardiomyocyte with NAPRT1 knockdown using the siRNA. Image from a verified customer review.

Applications for NAPRT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Knockdown Validated

Validated for Knockdown from a verified customer review.

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-87244 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAPRT1

Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress (Hara et al., 2007).[supplied by OMIM]

Alternate Names

EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856

Entrez Gene IDs

93100 (Human)

Gene Symbol

NAPRT

UniProt

Q6XQN6 (Human)

Additional NAPRT1 Products

Product Documents for NAPRT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NAPRT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NAPRT1 Antibody - BSA Free

Customer Reviews for NAPRT1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used NAPRT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • NAPRT1 Antibody
    Name: Shinichi Oka
    Application: Knockdown Validated
    Sample Tested: primary neonatal ventricular cardiomyocytes
    Species: Rat
    Verified Customer | Posted 11/28/2023
    Immunoblot using primary cultured rat cardiomyocyte with Naprt1 knockdown using the siRNA.
    NAPRT1 Antibody - BSA Free NBP1-87244
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies