NDUFA8 Antibody (2E10) - Azide and BSA Free

Novus Biologicals | Catalog # H00004702-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2E10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

NDUFA8 (NP_055037.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR

Specificity

Reacts with NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for NDUFA8 Antibody (2E10) - Azide and BSA Free

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05]

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05]

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody (M05), clone 2E10. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05]

Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05]

Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml
Sandwich ELISA: NDUFA8 Antibody (2E10) [H00004702-M05] - Detection limit for recombinant GST tagged NDUFA8 is 0.03 ng/ml as a capture antibody.

Applications for NDUFA8 Antibody (2E10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NDUFA8

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Alternate Names

CI-19kD, CI-PGIV, complex I PGIV subunit, Complex I-19kD, Complex I-PGIV, MGC793, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8, NADH:ubiquinone oxidoreductase PGIV subunit, NADH-ubiquinone oxidoreductase 19 kDa subunit, PGIV

Entrez Gene IDs

4702 (Human)

Gene Symbol

NDUFA8

Additional NDUFA8 Products

Product Documents for NDUFA8 Antibody (2E10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA8 Antibody (2E10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA8 Antibody (2E10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NDUFA8 Antibody (2E10) - Azide and BSA Free and earn rewards!

Have you used NDUFA8 Antibody (2E10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...