NDUFAF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25007

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFAF4 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein NDUFAF4 using the following amino acid sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFAF4 Antibody - BSA Free

NDUFAF4 Antibody Immunocytochemistry/Immunofluorescence: NDUFAF4 Antibody [NBP3-25007]

Immunocytochemistry/Immunofluorescence: NDUFAF4 Antibody [NBP3-25007]

Staining of human cell line U2OS shows localization to cytosol & mitochondria.

Applications for NDUFAF4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFAF4

NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency. (provided by RefSeq)

Alternate Names

bA22L21.1, C6orf66chromosome 6 open reading frame 66, Hormone-regulated proliferation-associated protein of 20 kDa, hormone-regulated proliferation-associated protein, 20 kDa, HRPAP20HSPC125, My013, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4

Gene Symbol

NDUFAF4

Additional NDUFAF4 Products

Product Documents for NDUFAF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFAF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFAF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFAF4 Antibody - BSA Free and earn rewards!

Have you used NDUFAF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies