NDUFS2 Antibody (9W2N4)

Novus Biologicals | Catalog # NBP3-33273

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9W2N4
View all NDUFS2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-434 of human NDUFS2 (NP_004541.1).

Sequence:
WDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFS2 Antibody (9W2N4)

NDUFS2 Antibody (9W2N4)

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] -

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] - Western blot analysis of various lysates, using NDUFS2 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
NDUFS2 Antibody (9W2N4)

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] -

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] - Western blot analysis of lysates from Rat heart, using NDUFS2 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
NDUFS2 Antibody (9W2N4)

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] -

Western Blot: NDUFS2 Antibody (9W2N4) [NBP3-33273] - Western blot analysis of various lysates using NDUFS2 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for NDUFS2 Antibody (9W2N4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFS2

Mitochondrial complex I (NADH-ubiquinone reductase; EC 1.6.5.3) is the first multimeric complex of the respiratory chain that catalyzes the NADH oxidation with concomitant ubiquinone reduction and proton ejection out of the mitochondria. Mammalian mitochondrial complex I is an assembly of at least 43 different subunits. Seven of the subunits are encoded by the mitochondrial genome; the remainder are the products of nuclear genes. The iron-sulfur protein (IP) fraction of complex I is made up of 7 subunits, including NDUFS2. See NDUFS1 (MIM 157655).[supplied by OMIM]

Alternate Names

CI-49, CI-49kD, complex 1, mitochondrial respiratory chain, 49-KD subunit, complex I 49kDa subunit, Complex I-49kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial, NADH-ubiquinone oxidoreductase 49 kDa subunit, NADH-ubiquinone oxidoreductase NDUFS2 subunit

Gene Symbol

NDUFS2

Additional NDUFS2 Products

Product Documents for NDUFS2 Antibody (9W2N4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFS2 Antibody (9W2N4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFS2 Antibody (9W2N4)

There are currently no reviews for this product. Be the first to review NDUFS2 Antibody (9W2N4) and earn rewards!

Have you used NDUFS2 Antibody (9W2N4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies