Neuromedin S Overexpression Lysate
Novus Biologicals | Catalog # NBP2-11002
Key Product Details
Species
Applications
Product Summary for Neuromedin S Overexpression Lysate
Neuromedin S Transient Overexpression Lysate
Expression Host: HEK293T
Plasmid: RC223176
Accession#: NM_001011717
Protein Tag: C-MYC/DDK
You will receive 1 vial of lysate (100ug) and 1 vial of empty vector negative control (100ug). Each vial of cell lysate contains 100ug of total protein (at 1 mg/ml).
Product Specifications
Application Notes
Each vial of cell lysate contains 100ug of total protein which should be sufficient for 20-50 reactions. Depending on over-expression level, antibody affinity and detection system, some lysates can go as low as 0.1 ug per load. We recommend starting with 5ug of cell lysate.
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Type
Scientific Data Images for Neuromedin S Overexpression Lysate
Western Blot: Neuromedin S Overexpression Lysate [NBP2-11002]
Western Blot: Neuromedin S Overexpression Lysate (Adult Normal) [NBP2-11002] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Neuromedin S.Formulation, Preparation, and Storage
Formulation
Concentration
Shipping
Storage
Background: Neuromedin S
Alternate Names
Gene Symbol
Additional Neuromedin S Products
Product Documents for Neuromedin S Overexpression Lysate
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Neuromedin S Overexpression Lysate
HEK293T cells in 10-cm dishes were transiently transfected with a non-lipid polymer transfection reagent specially designed and manufactured for large volume DNA transfection. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4, and then centrifuged to clarify the lysate. Protein concentration was measured by BCA protein assay kit.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Lysates are guaranteed for 6 months from date of receipt.
Related Research Areas
Customer Reviews for Neuromedin S Overexpression Lysate
There are currently no reviews for this product. Be the first to review Neuromedin S Overexpression Lysate and earn rewards!
Have you used Neuromedin S Overexpression Lysate?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Neuromedin S Overexpression Lysate
-
Q: Could you please let me know NMS antibody cross-reactivity with Neuromedin U? In addition to the query cross-reactivity of Neuromedin S Antibody (NBP1-87515) to Neuromedin U (NMU) whether in the image (imunohistochemistry-Paraffin: Neuromedin S Antibody [NBP1-87515] Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblasts), an experiment was done as a control after neutralizing the antibody with the immunogen used to raise the antibody.
A: This antibody has been raised using the following immunogenic sequence: RTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPF. Neuromedin U and Neuromedin S are less than 25% identical, and the sequence mentioned above does not show any similarity with the sequence of Neuromedin U. Therefore, I strongly believe that there should be no cross-reactivity. Generally speaking, I am sure that the product development & quality control teams test the specificity of most of the products using blocking experiments, however, I honestly do not have any such data on my records to share. At the moment we are not selling a peptide specific to this antibody, however, we have another product Neuromedin S Lysate (NBP2-11002) that you can find useful. Several of our customers choose lysates over the peptides for blocking experiments as the lysate contains full length protein and they find it more useful for comparison with their targets being analyzed.