Neuromedin S Overexpression Lysate

Novus Biologicals | Catalog # NBP2-11002

Novus Biologicals
Loading...

Key Product Details

Species

Human

Applications

Western Blot

Product Summary for Neuromedin S Overexpression Lysate

Neuromedin S Transient Overexpression Lysate


Expression Host: HEK293T

Plasmid: RC223176

Accession#: NM_001011717

Protein Tag: C-MYC/DDK

You will receive 1 vial of lysate (100ug) and 1 vial of empty vector negative control (100ug). Each vial of cell lysate contains 100ug of total protein (at 1 mg/ml).
Loading...

Product Specifications

Application Notes

This product is intended for use as a positive control in Western Blot. Overexpression of the target protein was confirmed using an antibody to DDK (FLAG) epitope tag (NBP1-71705) present on the protein construct.

Each vial of cell lysate contains 100ug of total protein which should be sufficient for 20-50 reactions. Depending on over-expression level, antibody affinity and detection system, some lysates can go as low as 0.1 ug per load. We recommend starting with 5ug of cell lysate.

Theoretical MW

3.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Type

Overexpression

Scientific Data Images for Neuromedin S Overexpression Lysate

Western Blot: Neuromedin S Overexpression Lysate [NBP2-11002]

Western Blot: Neuromedin S Overexpression Lysate [NBP2-11002]

Western Blot: Neuromedin S Overexpression Lysate (Adult Normal) [NBP2-11002] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Neuromedin S.

Formulation, Preparation, and Storage

Formulation

RIPA buffer

Concentration

The exact concentration of the protein of interest cannot be determined for overexpression lysates. Please contact technical support for more information.

Shipping

The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.

Storage

Store at -80C. Avoid freeze-thaw cycles.

Background: Neuromedin S

Alternate Names

BCS1L, BJS, FLGRACILE, NMS, PTD

Gene Symbol

NMS

Additional Neuromedin S Products

Product Documents for Neuromedin S Overexpression Lysate

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neuromedin S Overexpression Lysate

HEK293T cells in 10-cm dishes were transiently transfected with a non-lipid polymer transfection reagent specially designed and manufactured for large volume DNA transfection. Transfected cells were cultured for 48hrs before collection. The cells were lysed in modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4, and then centrifuged to clarify the lysate. Protein concentration was measured by BCA protein assay kit.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Lysates are guaranteed for 6 months from date of receipt.

Customer Reviews for Neuromedin S Overexpression Lysate

There are currently no reviews for this product. Be the first to review Neuromedin S Overexpression Lysate and earn rewards!

Have you used Neuromedin S Overexpression Lysate?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Neuromedin S Overexpression Lysate

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Could you please let me know NMS antibody cross-reactivity with Neuromedin U? In addition to the query cross-reactivity of Neuromedin S Antibody (NBP1-87515) to Neuromedin U (NMU) whether in the image (imunohistochemistry-Paraffin: Neuromedin S Antibody [NBP1-87515] Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblasts), an experiment was done as a control after neutralizing the antibody with the immunogen used to raise the antibody.

    A: This antibody has been raised using the following immunogenic sequence: RTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPF. Neuromedin U and Neuromedin S are less than 25% identical, and the sequence mentioned above does not show any similarity with the sequence of Neuromedin U. Therefore, I strongly believe that there should be no cross-reactivity. Generally speaking, I am sure that the product development & quality control teams test the specificity of most of the products using blocking experiments, however, I honestly do not have any such data on my records to share. At the moment we are not selling a peptide specific to this antibody, however, we have another product Neuromedin S Lysate (NBP2-11002) that you can find useful. Several of our customers choose lysates over the peptides for blocking experiments as the lysate contains full length protein and they find it more useful for comparison with their targets being analyzed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Lysates
Loading...