Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80057

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nicotinic Acetylcholine R alpha 4/CHRNA4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human CHRNA4. Peptide sequence AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP1-80057]

Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP1-80057]

Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP1-80057] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 4/CHRNA4

Nicotinic Acetylcholine Receptor alpha 4 encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor alpha 4

Alternate Names

BFNC, CHRNA4, EBN1, ENFL1, nAChR alpha 4, nAchRa4, NACRA4, Nicotinic Acetylcholine Ra4

Gene Symbol

CHRNA4

UniProt

NP_000735

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Product Documents for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies