Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94679

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nicotinic Acetylcholine R alpha 6/CHRNA6 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 350-440 of human CHRNA6 (NP_004189.1). PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 AntibodyBSA Free [NBP2-94679]

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 AntibodyBSA Free [NBP2-94679]

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody [NBP2-94679] - Analysis of extracts of various cell lines, using Nicotinic Acetylcholine R alpha 6/CHRNA6 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Applications for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 6/CHRNA6

Nicotinic acetylcholine receptors (nAChRs, AChRs) are protein complexes made up of protein subunits that coassemble to form an ion channel. This ion channel is gated through the binding of the neurotransmitter acetylcholine (ACh) to its ligand-binding site on the AChR. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA6 (cholinergic nicotinic receptor alpha polypeptide 6) is a neuronal acetylcholine receptor protein.

Long Name

Nicotinic Acetylcholine Receptor alpha 6

Alternate Names

CHRNA6, Nicotinic Acetylcholine Ra6

Gene Symbol

CHRNA6

Additional Nicotinic Acetylcholine R alpha 6/CHRNA6 Products

Product Documents for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies