Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84182

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Nicotinic Acetylcholine R alpha 9/CHRNA9. Peptide sequence: NWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVED The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody [NBP2-84182]

Western Blot: Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody [NBP2-84182]

Western Blot: Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody [NBP2-84182] - WB Suggested Anti-ACHA9 antibody Titration: 1 ug/mL. Sample Type: Human MCF7 Whole Cell

Applications for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 9/CHRNA9

CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor alpha 9

Alternate Names

CHRNA9, HSA243342, NACHRA9, Nicotinic Acetylcholine Ra 9

Gene Symbol

CHRNA9

Additional Nicotinic Acetylcholine R alpha 9/CHRNA9 Products

Product Documents for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...