Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10350

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACHB. Peptide sequence PLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLIS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine Receptor beta Antibody [NBP3-10350]

Western Blot: Nicotinic Acetylcholine Receptor beta Antibody [NBP3-10350]

Western Blot: Nicotinic Acetylcholine Receptor beta Antibody [NBP3-10350] - Western blot analysis of Nicotinic Acetylcholine Receptor beta in 721_B Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R beta 1/CHRNB1

The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one beta, one gamma, and one delta subunit. This gene encodes the beta subunit of the acetylcholine receptor. The acetylcholine receptor changes conformation upon acetylcholine binding leading to the opening of an ion-conducting channel across the plasma membrane. Mutations in this gene are associated with slow-channel congenital myasthenic syndrome.

Long Name

Nicotinic Acetylcholine Receptor beta 1

Alternate Names

ACHRB, CHRNB1, CMS1D, CMS2C, nAChRB1

Gene Symbol

CHRNB1

Additional Nicotinic Acetylcholine R beta 1/CHRNB1 Products

Product Documents for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine Receptor beta Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine Receptor beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine Receptor beta Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...