NKCC2/SLC12A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57622

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NKCC2/SLC12A1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC12A1(solute carrier family 12 (sodium/potassium/chloride transporters), member 1) The peptide sequence was selected from the N terminal of SLC12A1. Peptide sequence NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NKCC2/SLC12A1 Antibody - BSA Free

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Sample Tissue: Human A549 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: NKCC2/SLC12A1 Antibody [NBP1-57622]

Immunohistochemistry: NKCC2/SLC12A1 Antibody [NBP1-57622]

Immunohistochemistry: NKCC2/SLC12A1 Antibody [NBP1-57622] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622]

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-57622] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

Applications for NKCC2/SLC12A1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NKCC2/SLC12A1

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Long Name

Sodium/Potassium/Chloride Transporter NKCC2

Alternate Names

BSC1, SLC12A1

Entrez Gene IDs

6557 (Human)

Gene Symbol

SLC12A1

UniProt

Q8IUN5 (Human)

Additional NKCC2/SLC12A1 Products

Product Documents for NKCC2/SLC12A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NKCC2/SLC12A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NKCC2/SLC12A1 Antibody - BSA Free

Customer Reviews for NKCC2/SLC12A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NKCC2/SLC12A1 Antibody - BSA Free and earn rewards!

Have you used NKCC2/SLC12A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies