Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

Novus Biologicals | Catalog # H00114548-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human NLRP3/NALP3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

Recombinant Human NLRP3/NALP3 Protein [H00114548-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00114548-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NLRP3/NALP3

NACHT, LRR and PYD domains-containing protein 3 (NALP3), Nucleotide-Binding Oligomerization Domain, or Leucine Rich Repeat and Pyrin Domain Containing 3 (NLRP3) (human NLRP3-isoform 2 theoretical molecular weight 118kDa) acts as a cytosolic receptor for stress-signals initiated by a wide variety of pathogen-associated molecular patterns (PAMPS) and danger-associated molecular patterns (DAMPs) (1). NLRP3 belongs to the family of NOD-like receptors, a type of pattern-recognition receptor (PRR) which participates in innate immune responses. The exact mechanisms leading to NLRP3 activation are still not fully resolved. Some proposed mechanisms for NLRP3 inflammasome activation include induced ion channel flux as exemplified by potassium efflux, sodium influx and calcium signaling, generation of mitochondrial reactive oxygen species (ROS), and lysosomal destabilization (2). Activation of NLRP3 induces its association with the adaptor protein Apoptosis-associated Speck-like protein containing CARD (ASC) forming a complex that binds to Caspase-1 (1, 2). The inflammasome complex, comprised of NLRP3, ASC and Caspase 1, induces the processing of pro-IL-1beta and pro-IL-18 and release of the mature inflammatory cytokines IL-1beta and IL-18 and pyroptosis (1-3).

NLRP3 is expressed in a variety of cell types such as monocytes, dendritic cells, lymphocytes and epithelial cells (3). Abnormal NLRP3 activation may occur as the result of inherited mutations and is associated with diseases such as hereditary periodic fevers (HPFs) and familial cold autoinflammatory syndrome (FCAS). Additionally, abnormal NLRP3 activation is associated with a variety of diseases such as gout, obesity, atherosclerosis, Alzheimers, multiple sclerosis and type 2 diabetes (1, 3). NLRP3 inflammasome is regulated by several post-translational modifications (e.g., ubiquitination, phosphorylation and sumoylation) as well as by various interacting proteins (e.g., JNK1, FBXO3, TXNIP, MARK4 and PKD) (4).

References

1. Abderrazak, A., Syrovets, T., Couchie, D., El Hadri, K., Friguet, B., Simmet, T., & Rouis, M. (2015). NLRP3 inflammasome: From a danger signal sensor to a regulatory node of oxidative stress and inflammatory diseases. Redox Biology. https://doi.org/10.1016/j.redox.2015.01.008

2. Yang, Y., Wang, H., Kouadir, M., Song, H., & Shi, F. (2019). Recent advances in the mechanisms of NLRP3 inflammasome activation and its inhibitors. Cell Death and Disease. https://doi.org/10.1038/s41419-019-1413-8

3. Zahid, A., Li, B., Kombe, A. J. K., Jin, T., & Tao, J. (2019). Pharmacological inhibitors of the nlrp3 inflammasome. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2019.02538

4. Kelley, N., Jeltema, D., Duan, Y., & He, Y. (2019). The NLRP3 inflammasome: An overview of mechanisms of activation and regulation. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms20133328

Long Name

NLR Family, Pyrin Domain Containing 2

Alternate Names

AGTAVPRL, AII, CIAS1, Cryopyrin, FCAS, FCU, MWS, NACHT, NALP3, PYPAF1

Gene Symbol

NLRP3

Additional NLRP3/NALP3 Products

Product Documents for Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human NLRP3/NALP3 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human NLRP3/NALP3 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human NLRP3/NALP3 GST (N-Term) Protein

Showing  1 - 3 of 3 FAQs Showing All
    • A: Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
    • A: Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
    • A: The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.
Showing  1 - 3 of 3 FAQs Showing All
View all FAQs for Proteins and Enzymes