NOC2L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56871

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NOC2L Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NOC2L Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NOC2L Antibody [NBP2-56871]

Immunocytochemistry/ Immunofluorescence: NOC2L Antibody [NBP2-56871]

Immunocytochemistry/Immunofluorescence: NOC2L Antibody [NBP2-56871] - Staining of human cell line MCF7 shows localization to nucleoli.

Applications for NOC2L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOC2L

NOC2L is a transcriptional corepressor with inhibitor of histone acetyltransferase (INHAT) activity. NOC2L or NIR (Novel INHAT Repressor) is ubiquitously expressed throughout embryonic development and adulthood. It is a potent transcriptional corepressor that is not blocked by histone deacetylase inhibitors and is capable of silencing both basal and activator-driven transcription. NOC2L directly binds to nucleosomes and core histones and prevents acetylation by histone acetyltransferases, thus acting as a bona fide INHAT.

Alternate Names

DKFZp564C186, FLJ35172, NET15, NET7, NIR, NOC2-like protein, novel INHAT (inhibitor of histone acetyltransferase) repressor, nucleolar complex associated 2 homolog (S. cerevisiae), nucleolar complex protein 2 homolog, Protein NOC2 homolog

Gene Symbol

NOC2L

Additional NOC2L Products

Product Documents for NOC2L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOC2L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOC2L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOC2L Antibody - BSA Free and earn rewards!

Have you used NOC2L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies