NOD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48752

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NOD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Analysis in human skin and kidney tissues. Corresponding NOD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752]

Immunohistochemistry-Paraffin: NOD2 Antibody [NBP2-48752] - Staining of human kidney shows no positivity in cells in tubules as expected.

Applications for NOD2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOD2

NOD2 (nucleotide-binding oligomerization domain containing 2) is a member of the apoptosis regulating protein family that includes caspase recruitment-domains, as well as Apaf-1 and NOD1. It contains two N-terminal CARDs, a nucleotide binding domain (NBD), and multiple C-terminal leucine-rich repeats (LRRs). NOD2 is expressed in monocytes (whereas NOD1 is expressed in multiple tissues). NOD2 plays a role in regulating NF-kappaB. It also acts as an intracellular receptor for bacterial lipopolysaccharides and contributes to inflammatory bowel disease (IBD) and Crohn's disease.

Alternate Names

BLAU, CARD15caspase recruitment domain protein 15, caspase recruitment domain family, member 15, Caspase recruitment domain-containing protein 15, CDACUG, CLR16.3, IBD1NLR family, CARD domain containing 2, Inflammatory bowel disease protein 1, NLRC2, NOD-like receptor C2, nucleotide-binding oligomerization domain 2, nucleotide-binding oligomerization domain containing 2, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2, nucleotide-binding oligomerization domain-containing protein 2, PSORAS1NOD2B

Gene Symbol

NOD2

Additional NOD2 Products

Product Documents for NOD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOD2 Antibody - BSA Free and earn rewards!

Have you used NOD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NOD2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Can you suggest the best NOD2 antibody for detection of endogenous NOD2 in human fibroblasts?

    A: For detecting endogenous NOD2 in human samples, I would recommend NB100-524. This antibody has been validated for use in WB, IHC-Paraffin and IP.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...