NOP10 Antibody (6H6) - Azide and BSA Free

Novus Biologicals | Catalog # H00055505-M01-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 6H6

Format

Azide and BSA Free
View all NOP10 Primary Antibodies »

Product Specifications

Immunogen

NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for NOP10 Antibody (6H6) - Azide and BSA Free

Western Blot: NOP10 Antibody (6H6) [H00055505-M01-100ug]

Western Blot: NOP10 Antibody (6H6) [H00055505-M01-100ug]

Western Blot: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection against Immunogen (32.78 KDa).
ELISA: NOP10 Antibody (6H6) [H00055505-M01-100ug]

ELISA: NOP10 Antibody (6H6) [H00055505-M01-100ug]

ELISA: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.

Applications for NOP10 Antibody (6H6) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NOP10

The NOP10 gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Alternate Names

H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10

Entrez Gene IDs

55505 (Human)

Gene Symbol

NOP10

OMIM

606471 (Human)

UniProt

NP_061118.1 (Human)

Additional NOP10 Products

Product Documents for NOP10 Antibody (6H6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOP10 Antibody (6H6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOP10 Antibody (6H6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NOP10 Antibody (6H6) - Azide and BSA Free and earn rewards!

Have you used NOP10 Antibody (6H6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies