nSMase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35179

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all nSMase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human nSMase (NP_003071.2).

Sequence:
AHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for nSMase Antibody - BSA Free

nSMase Antibody

Western Blot: nSMase Antibody [NBP3-35179] -

Western Blot: nSMase Antibody [NBP3-35179] - Western blot analysis of various lysates using nSMase Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for nSMase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: nSMase

Sphingomyelin is also present in all eukaryotic cell membranes, especially the plasma membrane, and is particularly concentrated in the nervous system because sphingomyelin is a major component of myelin, the fatty insulation wrapped around nerve cells by Schwann cells or oligodendrocytes. Multiple Sclerosis is a disease characterised by deterioration of the myelin sheath, leading to impairment of nervous conduction. nSMase (Neutral sphingomyelinase; Sphingomyelin phosphodiesterase 2) converts sphingomyelin to ceramide. Although widely expressed in all tissues examined, except the spleen, high enzymatic activity occurs only in the brain. Mice lacking Smpd2 and Smpd3 are completely devoid of neutral SMase activity.

Alternate Names

EC 3.1.4.12, ISC1, Lyso-PAF-PLC, Lyso-platelet-activating factor-phospholipase C, Neutral sphingomyelinase, NSMASE, N-SMase, NSMASE1, sphingomyelin phosphodiesterase 2, sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Gene Symbol

SMPD2

Additional nSMase Products

Product Documents for nSMase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for nSMase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for nSMase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review nSMase Antibody - BSA Free and earn rewards!

Have you used nSMase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies