NUCKS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37908

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).

Sequence:
ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NUCKS1 Antibody - BSA Free

NUCKS1 Antibody

Western Blot: NUCKS1 Antibody [NBP3-37908] -

Western Blot: NUCKS1 Antibody [NBP3-37908] - Western blot analysis of lysates from Mouse lung, using NUCKS1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
NUCKS1 Antibody

Western Blot: NUCKS1 Antibody [NBP3-37908] -

Western Blot: NUCKS1 Antibody [NBP3-37908] - Western blot analysis of various lysates using NUCKS1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for NUCKS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NUCKS1

NUCKS (nuclear ubiquitous casein and cyclin-dependent kinases substrate) is a nuclear phosphoprotein phosphorylated by Cdk1 during mitosis. It is a DNA-binding protein and bears two putative nuclear localization signals. NUCKS has been shown to localize to the cytoplasm in mitotic cells and is targeted to the nucleus during telophase. It is expressed ubiquitously and possesses features of a housekeeping gene. Alternate names for NUCKS include NUCKS1, JC7, and FLJ21480.

Alternate Names

FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor

Gene Symbol

NUCKS1

Additional NUCKS1 Products

Product Documents for NUCKS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUCKS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUCKS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUCKS1 Antibody - BSA Free and earn rewards!

Have you used NUCKS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...