Nucleoporin 107 Antibody (8E6H4)

Novus Biologicals | Catalog # NBP3-33250

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8E6H4
View all Nucleoporin 107 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Nucleoporin 107 (P57740).

Sequence:
LASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

106 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nucleoporin 107 Antibody (8E6H4)

Nucleoporin 107 Antibody (8E6H4)

Western Blot: Nucleoporin 107 Antibody (8E6H4) [NBP3-33250] -

Western Blot: Nucleoporin 107 Antibody (8E6H4) [NBP3-33250] - Western blot analysis of various lysates using Nucleoporin 107 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Nucleoporin 107 Antibody (8E6H4)

Western Blot: Nucleoporin 107 Antibody (8E6H4) [NBP3-33250] -

Western Blot: Nucleoporin 107 Antibody (8E6H4) [NBP3-33250] - Western blot analysis of lysates from Rat brain, using Nucleoporin 107 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for Nucleoporin 107 Antibody (8E6H4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nucleoporin 107

Nucleoporin 107 encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is an essential component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq]

Alternate Names

nuclear pore complex protein Nup107, nucleoporin 107kDa, NUP84Nucleoporin Nup107,107 kDa nucleoporin

Gene Symbol

NUP107

Additional Nucleoporin 107 Products

Product Documents for Nucleoporin 107 Antibody (8E6H4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nucleoporin 107 Antibody (8E6H4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nucleoporin 107 Antibody (8E6H4)

There are currently no reviews for this product. Be the first to review Nucleoporin 107 Antibody (8E6H4) and earn rewards!

Have you used Nucleoporin 107 Antibody (8E6H4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies