NUDT21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57540

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NUDT21 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NUDT21 (nudix (nucleoside diphosphate linked moiety X)-type motif 21) The peptide sequence was selected from the N terminal of NUDT21. Peptide sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 5.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NUDT21 Antibody - BSA Free

Western Blot: NUDT21 Antibody [NBP1-57540]

Western Blot: NUDT21 Antibody [NBP1-57540]

Western Blot: NUDT21 Antibody [NBP1-57540] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: NUDT21 Antibody [NBP1-57540]

Immunohistochemistry-Paraffin: NUDT21 Antibody [NBP1-57540]

Immunohistochemistry-Paraffin: NUDT21 Antibody [NBP1-57540] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for NUDT21 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUDT21

NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Alternate Names

CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit

Gene Symbol

NUDT21

UniProt

O43809 (Human)

Additional NUDT21 Products

Product Documents for NUDT21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUDT21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUDT21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUDT21 Antibody - BSA Free and earn rewards!

Have you used NUDT21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies