NUP155 Antibody (9I10M5)

Novus Biologicals | Catalog # NBP3-33279

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9I10M5
View all NUP155 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 901-1050 of human NUP155 (NP_705618.1).

Sequence:
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLAD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

155 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NUP155 Antibody (9I10M5)

NUP155 Antibody (9I10M5)

Western Blot: NUP155 Antibody (9I10M5) [NBP3-33279] -

Western Blot: NUP155 Antibody (9I10M5) [NBP3-33279] - Western blot analysis of various lysates, using NUP155 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
NUP155 Antibody (9I10M5)

Western Blot: NUP155 Antibody (9I10M5) [NBP3-33279] -

Western Blot: NUP155 Antibody (9I10M5) [NBP3-33279] - Western blot analysis of lysates from Jurkat cells, using NUP155 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for NUP155 Antibody (9I10M5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NUP155

Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene. (provided by RefSeq)

Alternate Names

155 kDa nucleoporin, KIAA0791nucleoporin 155kD, N155, nuclear pore complex protein Nup155, nucleoporin 155kDa, Nucleoporin Nup155

Gene Symbol

NUP155

Additional NUP155 Products

Product Documents for NUP155 Antibody (9I10M5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUP155 Antibody (9I10M5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP155 Antibody (9I10M5)

There are currently no reviews for this product. Be the first to review NUP155 Antibody (9I10M5) and earn rewards!

Have you used NUP155 Antibody (9I10M5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies