NUP214 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58412

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NUP214 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY

Reactivity Notes

Mouse 83%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUP214 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NUP214 Antibody [NBP2-58412]

Immunocytochemistry/ Immunofluorescence: NUP214 Antibody [NBP2-58412]

Immunocytochemistry/Immunofluorescence: NUP214 Antibody [NBP2-58412] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for NUP214 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP214

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3' portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome.

Alternate Names

214 kDa nucleoporin, CAINputative oncogene, D9S46Enuclear pore complex protein Nup214, KIAA0023, MGC104525, N214, nucleoporin 214kD (CAIN), nucleoporin 214kDa, Nucleoporin Nup214, p250, Protein CAN

Gene Symbol

NUP214

Additional NUP214 Products

Product Documents for NUP214 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUP214 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP214 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUP214 Antibody - BSA Free and earn rewards!

Have you used NUP214 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies