NUP50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57627

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NUP50 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR

Reactivity Notes

Mouse 83%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit NUP50 Antibody - BSA Free (NBP2-57627) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for NUP50 Antibody - BSA Free

Western Blot: NUP50 Antibody [NBP2-57627]

Western Blot: NUP50 Antibody [NBP2-57627]

Western Blot: NUP50 Antibody [NBP2-57627] - Analysis using Anti-NUP50 antibody NBP2-57627 (A) shows similar pattern to independent antibody NBP2-13683 (B).
Immunocytochemistry/ Immunofluorescence: NUP50 Antibody [NBP2-57627]

Immunocytochemistry/ Immunofluorescence: NUP50 Antibody [NBP2-57627]

Immunocytochemistry/Immunofluorescence: NUP50 Antibody [NBP2-57627] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.

Applications for NUP50 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP50

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

50 kDa nucleoporin, MGC39961, NPAP60, NPAP60LNucleoporin Nup50, nuclear pore complex protein Nup50, Nuclear pore-associated protein 60 kDa-like, nuclear pore-associated protein 60L, nucleoporin 50kD, nucleoporin 50kDa

Gene Symbol

NUP50

Additional NUP50 Products

Product Documents for NUP50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUP50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUP50 Antibody - BSA Free and earn rewards!

Have you used NUP50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies