NUSAP1 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # H00051203-B01P
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
NUSAP1 (NP_057443.1, 1 a.a. - 226 a.a.) full-length human protein. MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED
Specificity
NUSAP1 - nucleolar and spindle associated protein 1,
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Scientific Data Images for NUSAP1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [H00051203-B01P]
Immunocytochemistry/Immunofluorescence: NUSAP1 Antibody [H00051203-B01P] - Analysis of purified antibody to NUSAP1 on HeLa cell. (antibody concentration 10 ug/ml)Western Blot: NUSAP1 Antibody [H00051203-B01P]
Western Blot: NUSAP1 Antibody [H00051203-B01P] - Analysis of NUSAP1 expression in transfected 293T cell line by NUSAP1 polyclonal antibody. Lane 1: NUSAP1 transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate.Western Blot: NUSAP1 Antibody [H00051203-B01P] -
Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUSAP1 Antibody [H00051203-B01P] -
Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation & causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. b The morphology & cell number of GBM cells after knocking down NUSAP1. c Viability of NUSAP1-knockdown GBM cells. d BrdU-positive GBM cells after knocking down NUSAP1. e Flow cytometry analyses of apoptosis in GBM cells with NUSAP1 knockdown. f The expression of the apoptotic proteins bcl2 & cleaved caspase-3 in cells with NUSAP1 knockdown. g Caspase-3/7 activity of GBM cells with NUSAP1 knockdown. All data are expressed as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUSAP1 Antibody [H00051203-B01P] -
Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NUSAP1 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:2000
Western Blot
1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: NUSAP1
Alternate Names
ANKTNUSAP, BM037, FLJ13421, LNP, nucleolar and spindle associated protein 1, nucleolar and spindle-associated protein 1, nucleolar protein ANKT, NuSAP, NuSAP1, PRO0310p1, Q0310, SAPL
Entrez Gene IDs
51203 (Human)
Gene Symbol
NUSAP1
UniProt
Additional NUSAP1 Products
Product Documents for NUSAP1 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NUSAP1 Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NUSAP1 Antibody - Azide and BSA Free
Customer Reviews for NUSAP1 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review NUSAP1 Antibody - Azide and BSA Free and earn rewards!
Have you used NUSAP1 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...