NUSAP1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00051203-B01P

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

NUSAP1 (NP_057443.1, 1 a.a. - 226 a.a.) full-length human protein. MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED

Specificity

NUSAP1 - nucleolar and spindle associated protein 1,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for NUSAP1 Antibody - Azide and BSA Free

Western Blot: NUSAP1 Antibody [H00051203-B01P]

Western Blot: NUSAP1 Antibody [H00051203-B01P]

NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0008.jpg
Western Blot: NUSAP1 Antibody [H00051203-B01P]

Western Blot: NUSAP1 Antibody [H00051203-B01P]

NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0007.jpg
Western Blot: NUSAP1 Antibody [H00051203-B01P]

Western Blot: NUSAP1 Antibody [H00051203-B01P]

NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0009.jpg
Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [H00051203-B01P]

Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [H00051203-B01P]

Immunocytochemistry/Immunofluorescence: NUSAP1 Antibody [H00051203-B01P] - Analysis of purified antibody to NUSAP1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: NUSAP1 Antibody [H00051203-B01P]

Western Blot: NUSAP1 Antibody [H00051203-B01P]

Western Blot: NUSAP1 Antibody [H00051203-B01P] - Analysis of NUSAP1 expression in transfected 293T cell line by NUSAP1 polyclonal antibody. Lane 1: NUSAP1 transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate.
NUSAP1 Antibody

Western Blot: NUSAP1 Antibody [H00051203-B01P] -

Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUSAP1 Antibody

Western Blot: NUSAP1 Antibody [H00051203-B01P] -

Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation & causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. b The morphology & cell number of GBM cells after knocking down NUSAP1. c Viability of NUSAP1-knockdown GBM cells. d BrdU-positive GBM cells after knocking down NUSAP1. e Flow cytometry analyses of apoptosis in GBM cells with NUSAP1 knockdown. f The expression of the apoptotic proteins bcl2 & cleaved caspase-3 in cells with NUSAP1 knockdown. g Caspase-3/7 activity of GBM cells with NUSAP1 knockdown. All data are expressed as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUSAP1 Antibody

Western Blot: NUSAP1 Antibody [H00051203-B01P] -

Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NUSAP1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NUSAP1

NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 (PubMed 12963707)).(supplied by OMIM)

Alternate Names

ANKTNUSAP, BM037, FLJ13421, LNP, nucleolar and spindle associated protein 1, nucleolar and spindle-associated protein 1, nucleolar protein ANKT, NuSAP, NuSAP1, PRO0310p1, Q0310, SAPL

Entrez Gene IDs

51203 (Human)

Gene Symbol

NUSAP1

Additional NUSAP1 Products

Product Documents for NUSAP1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUSAP1 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NUSAP1 Antibody - Azide and BSA Free

Customer Reviews for NUSAP1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NUSAP1 Antibody - Azide and BSA Free and earn rewards!

Have you used NUSAP1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...