Olig1 Antibody (3B3) - Azide and BSA Free

Novus Biologicals | Catalog # H00116448-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3B3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL

Reactivity Notes

Human. Other species not tested.

Specificity

OLIG1 (3B3)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Novus Biologicals Mouse Olig1 Antibody (3B3) - Azide and BSA Free (H00116448-M05) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Olig1 Antibody (3B3) - Azide and BSA Free

Immunoprecipitation: Olig1 Antibody (3B3) [H00116448-M05]

Immunoprecipitation: Olig1 Antibody (3B3) [H00116448-M05]

Immunoprecipitation: Olig1 Antibody (3B3) [H00116448-M05] - Analysis of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OLIG1 rabbit polyclonal antibody.

Applications for Olig1 Antibody (3B3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Olig1

Olig genes have been identified as the earliest known markers of oligodendrocyte lineage determination to date (Zhou et al., 2000). Olig1 is a transcription factor which promotes formation and maturation of oligodendrocytes, especially within the brain. It is expressed in the ventral spinal cord as early as 9.5 dpc and by 15.5 dpc, olig1 is dispersed throughout the gray matter. In the postnatal brain, it is present preferentially in the white matter, such as corpus callosum and cerebellar medulla. Olig1 has been demonstrated as necessary in the repair of brain lesions in patients with multiple sclerosis (Arnett et al. 2004).

Long Name

Oligodendrocyte Lineage Gene 1

Alternate Names

BHLHB6

Entrez Gene IDs

116448 (Human)

Gene Symbol

OLIG1

OMIM

606385 (Human)

Additional Olig1 Products

Product Documents for Olig1 Antibody (3B3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Olig1 Antibody (3B3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Olig1 Antibody (3B3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Olig1 Antibody (3B3) - Azide and BSA Free and earn rewards!

Have you used Olig1 Antibody (3B3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies