OPA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38494

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OPA3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 25-179 of human OPA3 (NP_079412.1).

Sequence:
NRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OPA3 Antibody - BSA Free

OPA3 Antibody

Western Blot: OPA3 Antibody [NBP3-38494] -

Western Blot: OPA3 Antibody [NBP3-38494] - Western blot analysis of various lysates using OPA3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for OPA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: OPA3

The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have beenshown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multipletranscript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Alternate Names

FLJ22187, FLJ25932, MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus'), MGC75494, optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia), optic atrophy 3 protein

Gene Symbol

OPA3

Additional OPA3 Products

Product Documents for OPA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OPA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OPA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OPA3 Antibody - BSA Free and earn rewards!

Have you used OPA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies