Opticin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55115

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Opticin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Opticin Antibody - BSA Free

Western Blot: Opticin Antibody [NBP2-55115]

Western Blot: Opticin Antibody [NBP2-55115]

Western Blot: Opticin Antibody [NBP2-55115] - Analysis in control (vector only transfected HEK293T lysate) and OPTC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human kidney.
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human eye shows moderate positivity in vitreous of the eye.
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody NBP2-55115 (A) shows similar protein distribution across tissues to independent antibody NBP1-85914 (B).
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115]

Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum.

Applications for Opticin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Opticin

Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1). [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Oculogylcan, OPTC

Gene Symbol

OPTC

Additional Opticin Products

Product Documents for Opticin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Opticin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Opticin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Opticin Antibody - BSA Free and earn rewards!

Have you used Opticin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies