ORC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17790

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ORC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ORC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ORC1 Antibody [NBP3-17790]

Immunocytochemistry/ Immunofluorescence: ORC1 Antibody [NBP3-17790]

Immunocytochemistry/Immunofluorescence: ORC1 Antibody [NBP3-17790] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for ORC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORC1

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. [provided by RefSeq]

Alternate Names

HS, HSORC1, ORC1Lorigin recognition complex subunit 1, origin recognition complex, subunit 1, origin recognition complex, subunit 1 (yeast homolog)-like, origin recognition complex, subunit 1 homolog, origin recognition complex, subunit 1 homolog (S. cerevisiae), origin recognition complex, subunit 1-like, origin recognition complex, subunit 1-like (yeast), PARC1origin recognition complex 1, Replication control protein 1

Gene Symbol

ORC1

Additional ORC1 Products

Product Documents for ORC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ORC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ORC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORC1 Antibody - BSA Free and earn rewards!

Have you used ORC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies