![Western Blot: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Western-Blot-NBP1-91108-img0019.jpg "Western Blot: OSTB Antibody [NBP1-91108]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for OSTB Antibody - BSA Free
Western Blot: OSTB Antibody [NBP1-91108]
Western Blot: OSTB Antibody [NBP1-91108] - Analysis in human cell line CACO-2 and human cell line U-2 OS.![Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Immunohistochemistry-Paraffin-NBP1-91108-img0017.jpg "Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]")
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human liver shows no positivity in hepatocytes.![Western Blot: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Western-Blot-NBP1-91108-img0018.jpg "Western Blot: OSTB Antibody [NBP1-91108]")
Western Blot: OSTB Antibody [NBP1-91108]
Western Blot: OSTB Antibody [NBP1-91108] - Analysis in human cell line CACO-2 and human cell line U-2 OS.![Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Immunohistochemistry-Paraffin-NBP1-91108-img0014.jpg "Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]")
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human small intestine shows strong membranous positivity in glandular cells.![Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Immunohistochemistry-Paraffin-NBP1-91108-img0015.jpg "Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]")
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]](https://resources.rndsystems.com/images/products/OSTB-Antibody-Immunohistochemistry-Paraffin-NBP1-91108-img0016.jpg "Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]")
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108]
Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.![OSTB Antibody - BSA Free Immunohistochemistry: OSTB Antibody - BSA Free [NBP1-91108]](https://resources.rndsystems.com/images/products/nbp1-91108_rabbit-polyclonal-ostb-antibody-29520251630575.jpg "Immunohistochemistry: OSTB Antibody - BSA Free [NBP1-91108]")
Applications for OSTB Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20-1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: OSTB
Alternate Names
FLJ26090, MGC118960, MGC118961, organic solute transporter beta, organic solute transporter subunit beta, OSTB
Gene Symbol
SLC51B
Additional OSTB Products
Product Documents for OSTB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for OSTB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for OSTB Antibody - BSA Free
There are currently no reviews for this product. Be the first to review OSTB Antibody - BSA Free and earn rewards!
Have you used OSTB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for OSTB Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I really need the OST beta antibody for human since it is related with my current research. Can this OSTB antibody (NBP1-91108) be used for the application of WB?
A: I actually just did a search and was able to track down OSTB on our site. I don't know how I didn't find it the first time, but we do have 1 antibody against this target that gets great reports from lab tests and customer feedback. Please se our SLC51B products. This antibody actually has been validated in WB. I have an image that I will get on the datasheet. It takes about 24 to 48 hours to display, but this will be guaranteed. It looks like we see a band slightly above the predicted weight in transfected cells between 17 and 28 kDa.
Loading...