OTUD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90484
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSAAEPVIVSRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for OTUD1 Antibody - BSA Free
Western Blot: OTUD1 Antibody - BSA Free [NBP1-90484] -
OTUD1 suppresses canonical NF-kappa B activation through the catalytic activity and the N-terminal region.a Screening for DUBs that regulate LUBAC-mediated NF-kappa B activation. Effects of 88 human DUBs on LUBAC-induced NF-kappa B activation were analyzed by a luciferase assay. b Dose-dependent inhibition by OTUD1 on LUBAC- and TNF-alpha -induced NF-kappa B activation. Effects of increasing amounts (0.1, 0.3, and 1.0 μg) of OTUD1 were examined with co-expression of LUBAC or 6 h treatment with 10 ng/ml TNF-alpha in HEK293T cells. c Domain structure of wild-type (Wt) and mutants of OTUD1. APGR: Ala-, Pro-, and Gly-rich region; OTU ovarian tumor protease, UIM ubiquitin-interacting motif. d Effect of OTUD1 mutants on the LUBAC-induced NF-kappa B activity. The relative NF-kappa B activity induced in the presence of Wt or various mutants of OTUD1, and expression levels of OTUD1 and LUBAC subunits are shown. a, b, d Data are shown as mean +/- SD by ANOVA post-hoc Tukey test (n = 3 or 4). *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001, NS not significant. e The N-terminal APGR region is disordered. Intrinsically ordered and disordered segments of OTUD1 were analyzed by DICHOT [12] (https://idp1.force.cs.is.nagoya-u.ac.jp/dichot/). f OTUD1 eluted in the high molecular weight fractions. Gel filtration analyses of lysates prepared from parental and OTUD1−/− cells, and FLAG-OTUD1-Wt- and FLAG-delta APGR-expressing HEK293T cells were performed using a Superdex 200 column. Concentrated fractions were subjected to immunoblotting with the indicated antibodies. *Non-specific signal. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41419-022-05145-5), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: OTUD1 Antibody [NBP1-90484]
Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: OTUD1 Antibody [NBP1-90484]
Staining of human lung shows strong cytoplasmic positivity in macrophages.Immunohistochemistry-Paraffin: OTUD1 Antibody [NBP1-90484]
Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.Immunohistochemistry-Paraffin: OTUD1 Antibody [NBP1-90484]
Staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells.Applications for OTUD1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: OTUD1
Alternate Names
OTDC1, OTU domain containing 1
Gene Symbol
OTUD1
Additional OTUD1 Products
Product Documents for OTUD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for OTUD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for OTUD1 Antibody - BSA Free
Customer Reviews for OTUD1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review OTUD1 Antibody - BSA Free and earn rewards!
Have you used OTUD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...