OTUD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35511

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OTUD4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-500 of human OTUD4 (NP_001096123.1).

Sequence:
LKSKQAQQKRDYSIAAGLQYEVGDKCQVRLDHNGKFLNADVQGIHSENGPVLVEELGKKHTSKNLKAPPPESWNTVSGKKMKKPSTSGQNFHSDVDYRGPKNPSKPIKAPSALPPRLQHPSGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQIIRKPDRERVEDFDHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSSSVNQSASQSSNPCVQRKSSHVGDRKGSRRRMDTEERKDKDSIHGHSQLDKRPEPSTLENITDDKYATVSSPSKSKKLECPSPAEQKPAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OTUD4 Antibody - BSA Free

OTUD4 Antibody

Immunocytochemistry/ Immunofluorescence: OTUD4 Antibody [NBP3-35511] -

Immunocytochemistry/ Immunofluorescence: OTUD4 Antibody [NBP3-35511] - Immunofluorescence analysis of PC-12 cells using OTUD4 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
OTUD4 Antibody

Western Blot: OTUD4 Antibody [NBP3-35511] -

Western Blot: OTUD4 Antibody [NBP3-35511] - Western blot analysis of various lysates using OTUD4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
OTUD4 Antibody

Immunocytochemistry/ Immunofluorescence: OTUD4 Antibody [NBP3-35511] -

Immunocytochemistry/ Immunofluorescence: OTUD4 Antibody [NBP3-35511] - Immunofluorescence analysis of NIH/3T3 cells using OTUD4 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for OTUD4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: OTUD4

OTUD4 is a gene that codes for a protein with four isoforms, with lengths of 1113, 210, 145, and 1048 amino acids and weights of approximately 124, 24, 17, and 117 kDa respectively. OTUD4 has been shown to have interactions with AGO2, ATG12, BAG5, DSG1, and FXR2.

Alternate Names

DKFZp434I0721, HIV-1 induced protein HIN-1, HIV-1-induced protein HIN-1, HSHIN1, KIAA1046HIN1DUBA6, OTU domain containing 4, OTU domain-containing protein 4

Gene Symbol

OTUD4

Additional OTUD4 Products

Product Documents for OTUD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OTUD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OTUD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OTUD4 Antibody - BSA Free and earn rewards!

Have you used OTUD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies