OVCA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57765

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OVCA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OVCA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OVCA1 Antibody [NBP2-57765]

Immunocytochemistry/ Immunofluorescence: OVCA1 Antibody [NBP2-57765]

Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP2-57765] - Staining of human cell line A549 shows localization to nucleoplasm & cell junctions.

Applications for OVCA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OVCA1

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]

Alternate Names

Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1

Gene Symbol

DPH1

Additional OVCA1 Products

Product Documents for OVCA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OVCA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OVCA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OVCA1 Antibody - BSA Free and earn rewards!

Have you used OVCA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies