P2Y11/P2RY11 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15501

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-379 of human P2Y11/P2RY11 (NP_002557.2). YVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for P2Y11/P2RY11 Antibody - Azide and BSA Free

Western Blot: P2Y11/P2RY11 AntibodyAzide and BSA Free [NBP3-15501]

Western Blot: P2Y11/P2RY11 AntibodyAzide and BSA Free [NBP3-15501]

Western Blot: P2Y11/P2RY11 Antibody [NBP3-15501] - Western blot analysis of extracts of various cell lines, using P2Y11/P2RY11 Rabbit pAb (NBP3-15501) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for P2Y11/P2RY11 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P2Y11/P2RY11

P2Y11, the only Purinergic Receptor that acts via cAMP, may be involved in the differentiation of immunocytes. Immature and mature dendritic cells express P2Y and P2X subtypes, including P2Y11, which are coupled to increases in intracellular Ca2+, membrane depolarization, and secretion of inflammatory cytokines. It has been suggested that ATP/P2Y11 contributes to sympathetic stimulation of renin, as well as to renin responses after tissue damage, such as that which occurs with kidney disease and myocardial infarct. Intergenic splicing between the P2Y11 and SSF1 genes changes gene expression, the first case involving a GPCR Communi et al., 2001. Prototypes for this cluster have been chosen to be uniquely P2Y11. P2Y11 has been reported in monocyte-derived dendritic cells, lymphocytes from patients with chronic lymphocytic leukemia, brain, heart, kidney, liver, skeletal muscle, spleen, and testis. ESTs have been isolated from normal human prostate, pancreas, and pooled brain, lung, and testis libraries.

Long Name

P2Y Purinergic Receptor 11

Alternate Names

P2RY11

Gene Symbol

P2RY11

Additional P2Y11/P2RY11 Products

Product Documents for P2Y11/P2RY11 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2Y11/P2RY11 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for P2Y11/P2RY11 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review P2Y11/P2RY11 Antibody - Azide and BSA Free and earn rewards!

Have you used P2Y11/P2RY11 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...