P4HA2 Antibody (6A6Z2)

Novus Biologicals | Catalog # NBP3-33334

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6A6Z2
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 157-333 of human P4HA2 (NP_004190.1).

Sequence:
GTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for P4HA2 Antibody (6A6Z2)

P4HA2 Antibody (6A6Z2)

Western Blot: P4HA2 Antibody (6A6Z2) [NBP3-33334] -

Western Blot: P4HA2 Antibody (6A6Z2) [NBP3-33334] - Western blot analysis of various lysates, using P4HA2 Rabbit mAb at1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.
P4HA2 Antibody (6A6Z2)

Western Blot: P4HA2 Antibody (6A6Z2) [NBP3-33334] -

Western Blot: P4HA2 Antibody (6A6Z2) [NBP3-33334] - Western blot analysis of various lysates, using P4HA2 Rabbit mAb at1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for P4HA2 Antibody (6A6Z2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P4HA2

P4HA2 encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

2-oxoglutarate-4-dioxygenase subunit alpha-2, 4-PH alpha 2, 4-PH alpha-2, alpha polypeptide II, collagen prolyl 4-hydroxylase alpha(II), C-P4Halpha(II), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-2, prolyl 4-hydroxylase, alpha polypeptide II

Gene Symbol

P4HA2

Additional P4HA2 Products

Product Documents for P4HA2 Antibody (6A6Z2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P4HA2 Antibody (6A6Z2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P4HA2 Antibody (6A6Z2)

There are currently no reviews for this product. Be the first to review P4HA2 Antibody (6A6Z2) and earn rewards!

Have you used P4HA2 Antibody (6A6Z2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...