p53 AIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13465

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all p53 AIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p53 AIP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: p53 AIP1 Antibody [NBP2-13465]

Immunohistochemistry-Paraffin: p53 AIP1 Antibody [NBP2-13465]

Immunohistochemistry-Paraffin: p53 AIP1 Antibody [NBP2-13465] Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.

Applications for p53 AIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p53 AIP1

The novel protein p53 AIP1, p53-regulated apoptosis inducing protein 1, has been identified from the direct cloning of p53 binding sequences from human genomic DNA. The expression of p53 AIP1 in mitochondria is induced by wild-type p53, which leads to apoptotic cell death through dissipation of mitochondrial Dym. Severe DNA damage causes the phosphorylation of p53 at Ser-46,p53 AIP1 expression, and apoptotic cell death. DNA damage-inducible apoptotic cell death was enhanced through transcriptional activation of p53 AIP1. P53R2 is directly regulated by p53 for supplying nucleotides to repair damaged DNA, thus plays a pivotal role in cell survival by repairing damaged DNA in the nucleus and that dysfunction of this pathway might result in activation of p53 dependent apoptosis to eliminate dangerous cells. In the opposite, p53 AIP1 is likely to play an important role in mediating p53-dependent apoptosis, and phosphorylation of Ser 46 regulates the transcriptional activation of this apoptosis inducing gene.

Alternate Names

P53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1

Gene Symbol

TP53AIP1

Additional p53 AIP1 Products

Product Documents for p53 AIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for p53 AIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p53 AIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p53 AIP1 Antibody - BSA Free and earn rewards!

Have you used p53 AIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies