p73 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58523

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p73 Antibody - BSA Free

Western Blot: p73 Antibody [NBP2-58523]

Western Blot: p73 Antibody [NBP2-58523]

Western Blot: p73 Antibody [NBP2-58523] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: p73 Antibody [NBP2-58523]

Immunocytochemistry/ Immunofluorescence: p73 Antibody [NBP2-58523]

Immunocytochemistry/Immunofluorescence: p73 Antibody [NBP2-58523] - Staining of human cell line HEK 293 shows localization to nucleus & the Golgi apparatus.
p73 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: p73 Antibody - BSA Free [NBP2-58523]

Chromatin Immunoprecipitation-exo-Seq: p73 Antibody - BSA Free [NBP2-58523]

ChIP-Exo-Seq composite graph for Anti-TP73 (NBP2-58523) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for p73 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p73

p73 is a transcription factor that shares a significant amino acid identity with p53 and p63 (1). p73 and p63 can both activate p53-responsive genes and induce apoptosis upon over expression (2) Unlike p53, p73 is not induced by DNA damage and is not a target for inactivation by viral oncoproteins (3). Similar to p63, p73 has an additional coding region in the C-terminus (not found in p53) that can undergo complex alternative splicing giving rise to 3 splice forms (alpha, beta, and gamma) (4). Activation of p73 requires the presence of functional c-Abl. It has also be found that mutant p53 can bind to and inactivate p73 (5).

Long Name

Tumor Protein p73

Alternate Names

TP73

Gene Symbol

TP73

Additional p73 Products

Product Documents for p73 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p73 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p73 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p73 Antibody - BSA Free and earn rewards!

Have you used p73 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...