PABP Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93914

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all PABP Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC1 (NP_002559.2). VTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PABP Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: PABP Antibody - Azide and BSA Free [NBP2-93914]

Immunohistochemistry-Paraffin: PABP Antibody - Azide and BSA Free [NBP2-93914]

Immunohistochemistry-Paraffin: PABP Antibody [NBP2-93914] - Paraffin-embedded rat testis using PABP.
Immunohistochemistry-Paraffin: PABP Antibody - Azide and BSA Free [NBP2-93914]

Immunohistochemistry-Paraffin: PABP Antibody - Azide and BSA Free [NBP2-93914]

Immunohistochemistry-Paraffin: PABP Antibody [NBP2-93914] - Paraffin-embedded human esophageal using PABP.
PABP Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] -

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] - Immunofluorescence analysis of NIH/3T3 cells using PABP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PABP Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] -

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] - Immunofluorescence analysis of MCF7 cells using PABP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PABP Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] -

Immunocytochemistry/ Immunofluorescence: PABP Antibody - Azide and BSA Free [PABP] - Immunofluorescence analysis of PC-12 cells using PABP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PABP Antibody - Azide and BSA Free

Western Blot: PABP Antibody - Azide and BSA Free [NBP2-93914] -

Western Blot: PABP Antibody - Azide and BSA Free [NBP2-93914] - Western blot analysis of various lysates, using PABP Rabbit pAb at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for PABP Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PABP

The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. Grange et al. (1987) isolated a melanoma cell cDNA encoding human PABP. The predicted 633-amino acid protein contains 4 repeats of an approximately 80-amino acid unit in its N-terminal half. The authors found that this repeat region is highly conserved between human and yeast PABP and is sufficient for poly(A) binding. In vitro translation of the human PABP cDNA yielded a protein with an apparent molecular mass of 73 kD by SDS-PAGE. Northern blot analysis indicated that PABP is expressed as a 2.9-kb mRNA in human melanoma cells. Gorlach et al. (1994) noted that each of the 4 repeats of PABP is a ribonucleoprotein (RNP) consensus sequence RNA-binding domain. They determined that PABP has a pI of approximately 10.3 and is a very abundant, stable protein. Immunofluorescence studies of mammalian cells indicated that PABP is located exclusively in the cytoplasm. However, using both indirect immunofluorescence and tagging of PABP1 by fusion to the green fluorescent protein (GFP), Afonina et al. (1998) demonstrated that PABP1 shuttles between the nucleus and cytoplasm. PABP1 accumulated in the nucleus when transcription was inhibited, suggesting that active transcription is required for nuclear export of PABP1.

Alternate Names

PAB1polyadenylate-binding protein 1, PABP, PABP-1, PABP1poly(A) binding protein, cytoplasmic 2, PABPC2, PABPL1, poly(A) binding protein, cytoplasmic 1, Poly(A)-binding protein 1, poly(A)-binding protein, cytoplasmic 2

Gene Symbol

PABPC1

Additional PABP Products

Product Documents for PABP Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PABP Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for PABP Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PABP Antibody - Azide and BSA Free and earn rewards!

Have you used PABP Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies