PAD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92240

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PAD3 Antibody - BSA Free

Western Blot: PAD3 Antibody [NBP1-92240]

Western Blot: PAD3 Antibody [NBP1-92240]

Western Blot: PAD3 Antibody [NBP1-92240] - Human cell lines RT-4 and PC-3 using Anti-PADI3 antibody. Corresponding PADI3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: PAD3 Antibody [NBP1-92240]

Immunocytochemistry/ Immunofluorescence: PAD3 Antibody [NBP1-92240]

Immunocytochemistry/Immunofluorescence: PAD3 Antibody [NBP1-92240] - Staining of human cell line A549 shows localization to nucleoplasma, cytosol and vesicles. Antibody staining is shown in green.
PAD3 Antibody - BSA Free Western Blot: PAD3 Antibody - BSA Free [NBP1-92240]

Western Blot: PAD3 Antibody - BSA Free [NBP1-92240]

Analysis in human cell lines RT-4 and PC-3 using Anti-PADI3 antibody. Corresponding PADI3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
PAD3 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PAD3 Antibody - BSA Free [NBP1-92240]

Immunocytochemistry/ Immunofluorescence: PAD3 Antibody - BSA Free [NBP1-92240]

Staining of human cell line A549 shows localization to nucleoplasma, cytosol and vesicles.

Applications for PAD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAD3

PADI3 / PAD3 catalyzes the deimination of arginine residues of proteins. It belongs to the protein arginine deiminase family.

Alternate Names

EC 3.5.3.15, MGC126307, PAD3, PDI3MGC126308, peptidyl arginine deiminase, type III, Peptidylarginine deiminase III, Protein-arginine deiminase type III, protein-arginine deiminase type-3

Entrez Gene IDs

51702 (Human)

Gene Symbol

PADI3

UniProt

Additional PAD3 Products

Product Documents for PAD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PAD3 Antibody - BSA Free

Customer Reviews for PAD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAD3 Antibody - BSA Free and earn rewards!

Have you used PAD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...